Toxins (Jul 2019)

αD-Conotoxins in Species of the Eastern Pacific: The Case of <i>Conus princeps</i> from Mexico

  • Arisaí C. Hernández-Sámano,
  • Andrés Falcón,
  • Fernando Zamudio,
  • César V.F. Batista,
  • Jesús Emilio Michel-Morfín,
  • Víctor Landa-Jaime,
  • Estuardo López-Vera,
  • Michael C. Jeziorski,
  • Manuel B. Aguilar

DOI
https://doi.org/10.3390/toxins11070405
Journal volume & issue
Vol. 11, no. 7
p. 405

Abstract

Read online

Conus snails produce venoms containing numerous peptides such as the α-conotoxins (α-CTXs), which are well-known nicotinic acetylcholine receptor (nAChR) antagonists. Thirty-eight chromatographic fractions from Conus princeps venom extract were isolated by RP-HPLC. The biological activities of 37 fractions (0.07 µg/µL) were assayed by two-electrode voltage clamp on human α7 nAChRs expressed in Xenopus laevis oocytes. Fractions F7 and F16 notably inhibited the response elicited by acetylcholine by 52.7 ± 15.2% and 59.6 ± 2.5%, respectively. Fraction F7 was purified, and an active peptide (F7-3) was isolated. Using a combination of Edman degradation, mass spectrometry, and RNASeq, we determined the sequence of peptide F7-3: AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSGKGHGCSCTS, with one hydroxyproline (O) and a free C-terminus. The average mass of this peptide, 10,735.54 Da, indicates that it is a homodimer of identical subunits, with 10 disulfide bonds in total. This peptide is clearly similar to αD-CTXs from species of the Indo-Pacific. Therefore, we called it αD-PiXXA. This toxin slowly and reversibly inhibited the ACh-induced response of the hα7 nAChR subtype, with an IC50 of 6.2 μM, and it does not affect the hα3β2 subtype at 6.5 μM.

Keywords